- Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 141R (IIV6-141R)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1077064
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 9,820 Da
- E Coli or Yeast
- 30682
- Uncharacterized protein 141R (IIV6-141R)
Sequence
MYYRRQGEPQEMYGNGNNSVSSSAVNTYQPYYKEDFNILDPALSDSQRYIIYAIVAAILLLLFWLLYKKYGHKIGRKGSVSMFY